PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P07310_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 726aa    MW: 78915.2 Da    PI: 5.6397
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P07310_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox36.77.4e-1299139141
                            TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-H CS
               Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLte 41 
                            +++ +++t++q++eLe++F+++++p+ ++r+eL+++lgL+ 
  GSMUA_Achr8P07310_001  99 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRELGLEP 139
                            688999*********************************86 PP

2START219.31.3e-682394591206
                            HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.. CS
                  START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.. 77 
                            ela +a++el+++a+++ep+W   +    e +n++e+++ ++++ +      ++ea+r+++vv+m+++++ve l+d++ qW+  +   
  GSMUA_Achr8P07310_001 239 ELAVAAMEELIRMAQLGEPLWIPGPdnatETLNEEEYVRALPRGIGpkpfgLNSEASRETAVVIMNQMNVVEMLMDVN-QWSSVFSsi 325
                            57899********************9999**************999********************************.********* PP

                            ..EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEE CS
                  START  78 ..kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliep 156
                              +a+tl+v+s+g      galq+ +ae+q++splvp R+++fvRy++q+++g+w++vdvS+ds ++ p    v R++++pSg+li++
  GSMUA_Achr8P07310_001 326 vsRAMTLQVLSTGvagnynGALQVLSAEFQVPSPLVPtRESLFVRYCKQHPDGTWAVVDVSLDSLRPSP----VLRCRRRPSGCLIQE 409
                            *******************************************************************98....7************** PP

                            ECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                  START 157 ksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                            ++ng+skvtwvehv++++r++h+l+++lv+sgla+gak+wv tl+rqce+
  GSMUA_Achr8P07310_001 410 LPNGYSKVTWVEHVEVDDRSVHNLYKPLVNSGLAFGAKRWVGTLNRQCER 459
                            ************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.5E-1486141IPR009057Homeodomain-like
SuperFamilySSF466894.28E-1087141IPR009057Homeodomain-like
PROSITE profilePS500718.85996141IPR001356Homeobox domain
SMARTSM003891.1E-497210IPR001356Homeobox domain
CDDcd000866.04E-1198141No hitNo description
PfamPF000461.8E-999139IPR001356Homeobox domain
PROSITE profilePS5084845.333230462IPR002913START domain
SuperFamilySSF559612.53E-36230461No hitNo description
CDDcd088754.78E-125234458No hitNo description
SMARTSM002341.4E-66239459IPR002913START domain
PfamPF018524.5E-58240459IPR002913START domain
Gene3DG3DSA:3.30.530.207.7E-7335459IPR023393START-like domain
SuperFamilySSF559611.21E-24478717No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    Send to blast
MPVGIMIPAR QAPSMIGRNT GTGYGSSSVL SLGQPNLLEG QQIPLQYQHH NQFMEIAPTT  60
TAESEMPRAR EEDFESKSGS ENIEVASGDD QDQSHRPRKK RYHRHTQHQI QELEAFFKEC  120
PHPDDKQRKE LSRELGLEPL QNHHERNENS QLRTENDKLR AENLRYKEAL TNASCPNCGG  180
PAALGEMSFD EHHLRIENAR LREEIDRISG IAAKYVGKPV MFGVGVSGQT DIEKPVVVEL  240
AVAAMEELIR MAQLGEPLWI PGPDNATETL NEEEYVRALP RGIGPKPFGL NSEASRETAV  300
VIMNQMNVVE MLMDVNQWSS VFSSIVSRAM TLQVLSTGVA GNYNGALQVL SAEFQVPSPL  360
VPTRESLFVR YCKQHPDGTW AVVDVSLDSL RPSPVLRCRR RPSGCLIQEL PNGYSKVTWV  420
EHVEVDDRSV HNLYKPLVNS GLAFGAKRWV GTLNRQCERL ASVMASNIPS GDIGVITTPE  480
GRKSMLKLAE RMVISFCGGV SASTTHQWTT LSGSGAEDVR VMTRKSVDDP GRPPGIVLNA  540
ATSFWLPVPP KRVFDFLRDE SSRSEWDILS NGGVVQEMAH IANGQDHGNC VSLLRVNSTN  600
SNQSNMLILQ ESCTDATGSY VIYAPVDVIA MNVVLNGGDP DYVALLPSGF SILPDGPTGG  660
GPGGGRINGG EEGGGSGGSL LTVAFQILVD SVPTAKLSLG SVATVNSLIA CTVERIKASV  720
AGEVAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009412012.10.0PREDICTED: homeobox-leucine zipper protein ROC2-like isoform X2
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLM0TND40.0M0TND4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P07310_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2